PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14148.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 230aa    MW: 26138.4 Da    PI: 9.8112
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14148.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.5e-18553148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                     +g+WT++Ed ll ++++ +G g+W+++ar+ g ++Rt+k+c++rw++yl
       KHN14148.1  5 KGPWTEQEDSLLFNYITVHGEGHWNSVARYTGsLKRTGKSCRLRWLNYL 53
                     79*********************************************97 PP

2Myb_DNA-binding50.25.9e-1659102146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
       KHN14148.1  59 RGNITLQEQLLILDLHSRWGNR-WSKIAEHLP-GRTDNEIKNYWRT 102
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.429157IPR017930Myb domain
SMARTSM007179.3E-15455IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-284100IPR009057Homeodomain-like
PfamPF002495.9E-16553IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-21660IPR009057Homeodomain-like
CDDcd001671.36E-11753No hitNo description
SMARTSM007171.1E-1358106IPR001005SANT/Myb domain
PROSITE profilePS5129418.37558108IPR017930Myb domain
PfamPF002491.9E-1459102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2161106IPR009057Homeodomain-like
CDDcd001671.08E-1063102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MLITKGPWTE QEDSLLFNYI TVHGEGHWNS VARYTGSLKR TGKSCRLRWL NYLRPNVRRG  60
NITLQEQLLI LDLHSRWGNR WSKIAEHLPG RTDNEIKNYW RTRVVKQAKQ LKCDVNSKQF  120
RDTLRFVWMP RMLERIRAQA SSSAQAHQSS LISNSNTQAH SGLLSSALHA HAPSLSDSSA  180
SYNLMGADAG SCSSHSYYSD IAGNGFGGAD LWTDQNICFL QHQLAHHDLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-24310025120MYB TRANSFORMING PROTEIN
1mse_C3e-242100197C-Myb DNA-Binding Domain
1msf_C3e-242100197C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0973790.0BT097379.1 Soybean clone JCVI-FLGm-16I17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242391.11e-158MYB12 protein
SwissprotQ9LDE13e-67MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0B2Q2E51e-172A0A0B2Q2E5_GLYSO; Transcription factor MYB21
STRINGGLYMA03G38040.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.12e-72myb domain protein 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]